SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP56350_P050
Price: $0.00
SKU
ARP56350_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MMP13 (ARP56350_P050) antibody
Product Info
Tested Species ReactivityHuman, Horse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MMP13
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Yeast: 83%
Peptide SequenceSynthetic peptide located within the following region: HFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET
Concentration0.5 mg/ml
Blocking PeptideFor anti-MMP13 (ARP56350_P050) antibody is Catalog # AAP56350 (Previous Catalog # AAPP38415)
ReferenceBorghese,B., (2008) Hum. Reprod. 23 (5), 1207-1213
Publications

Clusterin secretion is attenuated by the proinflammatory cytokines interleukin-1β and tumor necrosis factor-α in models of cartilage degradation. J Orthop Res. (2020) 32725904

Intra-Articular Administration of Cramp into Mouse Knee Joint Exacerbates Experimental Osteoarthritis Progression. Int J Mol Sci. 22 (2021). 33810460

Park, Y. S. et al. Controlled release of simvastatin from in situ forming hydrogel triggers bone formation in MC3T3-E1 cells. AAPS J. 15, 367-76 (2013). 23250670

Description
Gene SymbolMMP13
Gene Full NameMatrix metallopeptidase 13 (collagenase 3)
Alias SymbolsCLG3, MDST, MANDP1, MMP-13
NCBI Gene Id4322
Protein NameCollagenase 3
Description of TargetProteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as art
Uniprot IDP45452
Protein Accession #NP_002418
Nucleotide Accession #NM_002427
Protein Size (# AA)471
Molecular Weight42kDa
Protein InteractionsADAMTS5; MMP14; BCAN; MMP13; F12; TIMP3; CCL7; COL2A1; LRP1;
  1. What is the species homology for "MMP13 Antibody - middle region (ARP56350_P050)"?

    The tested species reactivity for this item is "Human, Horse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast".

  2. How long will it take to receive "MMP13 Antibody - middle region (ARP56350_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MMP13 Antibody - middle region (ARP56350_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MMP13 Antibody - middle region (ARP56350_P050)"?

    This target may also be called "CLG3, MDST, MANDP1, MMP-13" in publications.

  5. What is the shipping cost for "MMP13 Antibody - middle region (ARP56350_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MMP13 Antibody - middle region (ARP56350_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MMP13 Antibody - middle region (ARP56350_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MMP13 Antibody - middle region (ARP56350_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MMP13"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MMP13"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MMP13"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MMP13"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MMP13"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MMP13"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MMP13 Antibody - middle region (ARP56350_P050)
Your Rating
We found other products you might like!